
| Name | T-cell surface glycoprotein CD8 alpha chain | ||
| UniProt ID | CD8A_HUMAN | ||
| Gene Name | CD8A | ||
| Gene ID | 925 | ||
| Synonyms |
CD8A, CD8, CD8alpha, IMD116, Leu2, p32
|
||
| Sequence |
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa925 | ||
| TTD ID | T20978 | ||
| Pfam | PF00047; PF07679; PF07686; PF13895; PF13927 | ||
| Pair Name | Camptothecin, Camptosar | |||
| Phytochemical | Camptothecin | |||
| Drug | Camptosar | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | T-cell surface glycoprotein CD8 alpha chain | Expression | |
| Result | Camptothesome Potentiates PD-L1 Immune Checkpoint Blockade for Improved Metastatic Triple-Negative Breast Cancer Immunochemotherapy | |||
| Pair Name | Quercetin, Anti-PD-1 antibody | |||
| Phytochemical | Quercetin | |||
| Drug | Anti-PD-1 antibody | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | T-cell surface glycoprotein CD8 alpha chain | Expression | |
| Result | Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity. | |||
| Pair Name | Ginsenoside Rb1, Apatinib | |||
| Phytochemical | Ginsenoside Rb1 | |||
| Drug | Apatinib | |||
| Disease Info | [ICD-11: 2B6E] | Hypopharyngeal carcinoma | Investigative | |
| Regulate Info | Down-regulation | T-cell surface glycoprotein CD8 alpha chain | Expression | |
| Result | A combination of apatinib and G-Rb1 induced more tumor cell apoptosis and reduced cell proliferation than the individual drug treatment and promote antitumor immunity by enhancing immunomodulatory molecules. Thus, we believe that this study could serve as a valuable platform to assess the synergetic anticancer effects of the herbal as well as synthetic medicines. | |||
| Pair Name | Carnosic acid, Cisplatin | |||
| Phytochemical | Carnosic acid | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | T-cell surface glycoprotein CD8 alpha chain | Expression | |
| Result | Our study proved that the functional suppression of MDSC by carnosic acid promoted the lethality of CD8 T cells, which contributed to the enhancement of anti-lung cancer effect of cisplatin. | |||
| Pair Name | Curcumin, Docetaxel | |||
| Phytochemical | Curcumin | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2C31.Z] | Head and neck squamous cell carcinoma | Investigative | |
| Regulate Info | Up-regulation | T-cell surface glycoprotein CD8 alpha chain | Expression | |
| Result | Curcumin Enhances the Efficacy of Docetaxel by Promoting Anti-Tumor Immune Response in Head and Neck Squamous Cell Carcinoma | |||
| No. | Title | Href |
|---|---|---|
| 1 | Camptothesome Potentiates PD-L1 Immune Checkpoint Blockade for Improved Metastatic Triple-Negative Breast Cancer Immunochemotherapy. Mol Pharm. 2022 Dec 5;19(12):4665-4674. doi: 10.1021/acs.molpharmaceut.2c00701. | Click |
| 2 | Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. | Click |
| 3 | Apatinib and Ginsenoside-Rb1 Synergetically Control the Growth of Hypopharyngeal Carcinoma Cells. Dis Markers. 2022 Jan 13;2022:3833489. doi: 10.1155/2022/3833489. | Click |
| 4 | Carnosic acid enhances the anti-lung cancer effect of cisplatin by inhibiting myeloid-derived suppressor cells. Chin J Nat Med. 2018 Dec;16(12):907-915. doi: 10.1016/S1875-5364(18)30132-8. | Click |
| 5 | Curcumin Enhances the Efficacy of Docetaxel by Promoting Anti-Tumor Immune Response in Head and Neck Squamous Cell Carcinoma. Cancer Invest. 2023 May;41(5):524-533. doi: 10.1080/07357907.2023.2194420. | Click |