| Name | G1/S-specific cyclin-D3 | ||
| UniProt ID | CCND3_HUMAN | ||
| Gene Name | CCND3 | ||
| Gene ID | 896 | ||
| Synonyms |
CCND3
|
||
| Sequence |
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa896 | ||
| TTD ID | T72507 | ||
| Pfam | PF00134; PF02984; PF09080 | ||
| Pair Name | Lycorine hydrochloride, Anti-CTLA-4 | |||
| Phytochemical | Lycorine hydrochloride | |||
| Drug | Anti-CTLA-4 | |||
| Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | G1/S-specific cyclin-D3 | Expression | |
| Result | Synergistic effects of the immune checkpoint inhibitor CTLA-4 combined with the growth inhibitor lycorine in a mouse model of renal cell carcinoma | |||
| Pair Name | Delta-Tocotrienol, Cisplatin | |||
| Phytochemical | Delta-Tocotrienol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Down-regulation | G1/S-specific cyclin-D3 | Expression | |
| Result | δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis | |||
| No. | Title | Href |
|---|---|---|
| 1 | Synergistic effects of the immune checkpoint inhibitor CTLA-4 combined with the growth inhibitor lycorine in a mouse model of renal cell carcinoma. Oncotarget. 2017 Mar 28;8(13):21177-21186. doi: 10.18632/oncotarget.15505. | Click |
| 2 | δ-Tocotrienol sensitizes and re-sensitizes ovarian cancer cells to cisplatin via induction of G1 phase cell cycle arrest and ROS/MAPK-mediated apoptosis. Cell Prolif. 2021 Nov;54(11):e13111. doi: 10.1111/cpr.13111. | Click |
