| Name | BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 | ||
| UniProt ID | BNIP3_HUMAN | ||
| Gene Name | BNIP3 | ||
| Gene ID | 664 | ||
| Synonyms |
BNIP3, HABON, NIP3
|
||
| Sequence |
MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSK
SSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDW SSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLG IYIGRRLTTSTSTF |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.A.20.1.1 | ||
| KEGG ID | hsa664 | ||
| Pfam | PF06553; PF20070 | ||
| Pair Name | Astaxanthin, Sorafenib | |||
| Phytochemical | Astaxanthin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 | Expression | |
| Result | Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment | |||
| Pair Name | Gossypol, BRD4770 | |||
| Phytochemical | Gossypol | |||
| Drug | BRD4770 | |||
| Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
| Regulate Info | Up-regulation | BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 | Expression | |
| Result | The combination of gossypol and BRD4770 increased LC3-II levels and the autophagosome number in PANC-1 cells, and the compound combination appears to act in a BNIP3 (B-cell lymphoma 2 19-kDa interacting protein)-dependent manner, suggesting that these compounds act together to induce autophagy-related cell death in pancreatic cancer cells. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment. Mol Nutr Food Res. 2024 Jan;68(2):e2300569. doi: 10.1002/mnfr.202300569. | Click |
| 2 | Gossypol and an HMT G9a inhibitor act in synergy to induce cell death in pancreatic cancer cells. Cell Death Dis. 2013 Jun 27;4(6):e690. doi: 10.1038/cddis.2013.191. | Click |
