| Name | Aurora kinase B | ||
| UniProt ID | AURKB_HUMAN | ||
| Gene Name | AURKB | ||
| Gene ID | 9212 | ||
| Synonyms |
AURKB, AIK2, AIM-1, AIM1, ARK-2, ARK2, AurB, IPL1, PPP1R48, STK-1, STK12, STK5, aurkb-sv1, aurkb-sv2
|
||
| Sequence |
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa9212 | ||
| TTD ID | T46781 | ||
| Pfam | PF00069; PF03109; PF07714; PF14531 | ||
| Pair Name | Tanshinone IIA, Aurora kinase inhibitor | |||
| Phytochemical | Tanshinone IIA | |||
| Drug | Aurora kinase inhibitor | |||
| Disease Info | [ICD-11: 2B66.0] | Oral squamous cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | Aurora kinase B | Phosphorylation | |
| Result | Targeting Aurora B kinase with Tanshinone IIA suppresses tumor growth and overcomes radioresistance | |||
| Pair Name | Capsaicin, Cisplatin | |||
| Phytochemical | Capsaicin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | Aurora kinase B | Expression | |
| Result | Capsaicin induces apoptosis of cisplatin-resistant stomach cancer cells by causing degradation of cisplatin-inducible Aurora-A protein | |||
| No. | Title | Href |
|---|---|---|
| 1 | Targeting Aurora B kinase with Tanshinone IIA suppresses tumor growth and overcomes radioresistance. Cell Death Dis. 2021 Feb 4;12(2):152. doi: 10.1038/s41419-021-03434-z. | Click |
| 2 | Capsaicin induces apoptosis of cisplatin-resistant stomach cancer cells by causing degradation of cisplatin-inducible Aurora-A protein. Nutr Cancer. 2011;63(7):1095-1103. doi:10.1080/01635581.2011.607548. | Click |
