| Name | Taurine up-regulated 1 protein | ||
| UniProt ID | TUG1_HUMAN | ||
| Gene Name | TUG1 | ||
| Gene ID | 55000 | ||
| Synonyms |
TUG1, LINC00080, NCRNA00080, TI-227H
|
||
| Sequence |
MARPPPLPGLVGRRNGRAVDRAIGWRLFLLLWHPALGAQARPPRRAPGGRWRSRRVFLLV
RRTRAAAYAFAIRRGVVRVVGGGGQLLRPAPGEAAAAAAAGFGAAGEAGVAGAGLEAWRH PSGPARTQLGGQEGAGGWLVVGFLLCLFLLMPP |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa55000 | ||
| Pair Name | Solamargine, Sorafenib | |||
| Phytochemical | Solamargine | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Taurine up-regulated 1 protein | Expression | |
| Result | Our study revealed that SM inhibited the growth of HCC and enhanced the anticancer effect of SF through HOTTIP-TUG1/miR-4726-5p/MUC1 signaling pathway. These findings will provide potential therapeutic targets and strategies for the treatment of HCC. | |||
