| Name | Tribbles homolog 3 | ||
| UniProt ID | TRIB3_HUMAN | ||
| Gene Name | TRIB3 | ||
| Gene ID | 57761 | ||
| Synonyms |
TRIB3, C20orf97, NIPK, SINK, SKIP3, TRB3
|
||
| Sequence |
MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRAT
AVATASRLGPYVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV ARPTEVLAGTQLLYAFFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVL RDLKLCRFVFADRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGK AADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYALPAGLSAPARCLVRCLLRREP AERLTATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDGLGLDEAREEEGDREVVLYG |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa57761 | ||
| Pfam | PF00069; PF07714 | ||
| Pair Name | alpha-Hydroxylinoleic acid, Paclitaxel | |||
| Phytochemical | alpha-Hydroxylinoleic acid | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Tribbles homolog 3 | Expression | |
| Result | The safety profile of ABTL0812 and its good synergy with chemotherapy potentiate the therapeutic potential of current lines of treatment based on chemotherapy regimens, arising as a promising option for improving these patients therapeutic expectancy. | |||
| Pair Name | alpha-Hydroxylinoleic acid, Paclitaxel | |||
| Phytochemical | alpha-Hydroxylinoleic acid | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Tribbles homolog 3 | Expression | |
| Result | ABTL0812 enhances antitumor effect of paclitaxel and reverts chemoresistance in triple-negative breast cancer models. | |||
| No. | Title | Href |
|---|---|---|
| 1 | The novel proautophagy anticancer drug ABTL0812 potentiates chemotherapy in adenocarcinoma and squamous nonsmall cell lung cancer. Int J Cancer. 2020 Aug 15;147(4):1163-1179. doi: 10.1002/ijc.32865. | Click |
| 2 | ABTL0812 enhances antitumor effect of paclitaxel and reverts chemoresistance in triple-negative breast cancer models. Cancer Commun (Lond). 2022 Jun;42(6):567-571. doi: 10.1002/cac2.12282. | Click |
