Name | Ribonucleoside-diphosphate reductase subunit M2 | ||
UniProt ID | RIR2_HUMAN | ||
Gene Name | RRM2 | ||
Gene ID | 6241 | ||
Synonyms |
RRM2, C2orf48, R2, RR2, RR2M
|
||
Sequence |
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKT
KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLK PEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI DTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSF ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTN FFEKRVGEYQRMGVMSSPTENSFTLDADF |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa6241 | ||
TTD ID | T38301 | ||
Pfam | PF00268 |
Pair Name | Gambogic Acid, Gemcitabine | |||
Phytochemical | Gambogic Acid | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Ribonucleoside-diphosphate reductase subunit M2 | Expression | |
Result | These results offer a rationale to evaluate the clinical translational possibility of GA as adjuvant therapy to overcome Gem resistance. This combination regimen can be a new therapeutic concept to eradicate this devastating disease. |
Pair Name | Gambogic Acid, Gemcitabine | |||
Phytochemical | Gambogic Acid | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Ribonucleoside-diphosphate reductase subunit M2 | Expression | |
Result | These results demonstrate that gambogic acid sensitizes pancreatic cancer cells to gemcitabine in vitro and in vivo by inhibiting the activation of the ERK/E2F1/RRM2 signaling pathway. The results also indicate that gambogic acid treatment combined with gemcitabine might be a promising chemotherapy strategy for pancreatic cancer. |
No. | Title | Href |
---|---|---|
1 | Gambogic acid potentiates gemcitabine induced anticancer activity in non-small cell lung cancer. Eur J Pharmacol. 2020 Dec 5;888:173486. doi: 10.1016/j.ejphar.2020.173486. | Click |
2 | Gambogic acid sensitizes gemcitabine efficacy in pancreatic cancer by reducing the expression of ribonucleotide reductase subunit-M2 (RRM2). J Exp Clin Cancer Res. 2017 Aug 10;36(1):107. doi: 10.1186/s13046-017-0579-0. | Click |