| Name | Metallothionein-1G | ||
| UniProt ID | MT1G_HUMAN | ||
| Gene Name | MT1G | ||
| Gene ID | 4495 | ||
| Synonyms |
MT1G, MT1, MT1K
|
||
| Sequence |
MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC
CA |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa4495 | ||
| Pfam | PF00131 | ||
| Pair Name | Camptothecin, Sorafenib | |||
| Phytochemical | Camptothecin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Metallothionein-1G | Expression | |
| Result | The synergetic combination significantly increases lipid peroxidation and iron concentration, decreases TAC, GPX4 and GR activity, and reduces the expression of both Nrf2 and SLC7A11. The downregulation of Nrf2 expression has a vital role in the reduction of resistance mediators to sorafenib against HCC cells like (p62, MT1G, and ABCG2) and improves the cellular uptake of sorafenib. The current study provided evidence that Nrf2 inhibition by CPT improves sorafenib's sensitivity and reduces sorafenib's resistance via the augmentation of sorafenib's ferroptosis action. | |||
