| Name | Interleukin-10 | ||
| UniProt ID | IL10_HUMAN | ||
| Gene Name | IL10 | ||
| Gene ID | 3586 | ||
| Synonyms |
IL10, CSIF, GVHDS, IL-10, IL10A, TGIF
|
||
| Sequence |
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa3586 | ||
| TTD ID | T09092 | ||
| Pfam | PF00726; PF13949; PF14565; PF16526 | ||
| Pair Name | Quercetin, Anti-PD-1 antibody | |||
| Phytochemical | Quercetin | |||
| Drug | Anti-PD-1 antibody | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Interleukin-10 | Expression | |
| Result | Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity. | |||
| Pair Name | Rosmarinic acid, Indoleamine 2,3-dioxygenase 1 | |||
| Phytochemical | Rosmarinic acid | |||
| Drug | Indoleamine 2,3-dioxygenase 1 | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Interleukin-10 | Expression | |
| Result | The mechanism might be related to regulating immune response and immunocytokines, as well as alleviating immunosuppression induced by Tregs in the tumor immune microenvironment. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. | Click |
| 2 | Effects of gene silencing of indoleamine 2,3-dioxygenase 1 combined with rosmarinic acid on tumor immune microenvironment in H22 tumor-bearing mice. Int Immunopharmacol. 2023 Jun;119:110193. doi: 10.1016/j.intimp.2023.110193. | Click |
