| Name | Growth arrest and DNA damage-inducible protein GADD45 alpha | ||
| UniProt ID | GA45A_HUMAN | ||
| Gene Name | GADD45A | ||
| Gene ID | 1647 | ||
| Synonyms |
GADD45A, DDIT1, GADD45
|
||
| Sequence |
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa1647 | ||
| TTD ID | T23409 | ||
| Pfam | PF01248 | ||
| Pair Name | Beta-Elemene, Cisplatin | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Growth arrest and DNA damage-inducible protein GADD45 alpha | Expression | |
| Result | β-elemenal may have greater potential as an anticancer alternative to β-elemene in treating lung cancer and other tumors. | |||
| Pair Name | Luteolin, Lapatinib | |||
| Phytochemical | Luteolin | |||
| Drug | Lapatinib | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Growth arrest and DNA damage-inducible protein GADD45 alpha | Expression | |
| Result | These data suggest that the combination of Lapatinib and luteolin may inhibit HER2 human breast cancer by significantly increasing the expression of FOXO3a and NQO1, two key genes in HER2 human breast cancer xenografts. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Sensitization of lung cancer cells to cisplatin by β-elemene is mediated through blockade of cell cycle progression: antitumor efficacies of β-elemene and its synthetic analogs. Med Oncol. 2013 Mar;30(1):488. doi: 10.1007/s12032-013-0488-9. | Click |
| 2 | Combination of Lapatinib and luteolin enhances the therapeutic efficacy of Lapatinib on human breast cancer through the FOXO3a/NQO1 pathway. Biochem Biophys Res Commun. 2020 Oct 20;531(3):364-371. doi: 10.1016/j.bbrc.2020.07.049. | Click |
