
| Name | T-cell surface glycoprotein CD4 | ||
| UniProt ID | CD4_HUMAN | ||
| Gene Name | CD4 | ||
| Gene ID | 920 | ||
| Synonyms |
CD4, CD4mut, IMD79, Leu-3, OKT4D, T4
|
||
| Sequence |
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 8.A.23.2.1 | ||
| KEGG ID | hsa920 | ||
| TTD ID | T10191 | ||
| Pfam | PF00047; PF05790; PF07679; PF07686; PF09191; PF11465; PF12104; PF13895; PF13927 | ||
| Pair Name | Quercetin, Anti-PD-1 antibody | |||
| Phytochemical | Quercetin | |||
| Drug | Anti-PD-1 antibody | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | T-cell surface glycoprotein CD4 | Expression | |
| Result | Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity. | |||
| Pair Name | Ginsenoside Rb1, Apatinib | |||
| Phytochemical | Ginsenoside Rb1 | |||
| Drug | Apatinib | |||
| Disease Info | [ICD-11: 2B6E] | Hypopharyngeal carcinoma | Investigative | |
| Regulate Info | Up-regulation | T-cell surface glycoprotein CD4 | Expression | |
| Result | A combination of apatinib and G-Rb1 induced more tumor cell apoptosis and reduced cell proliferation than the individual drug treatment and promote antitumor immunity by enhancing immunomodulatory molecules. Thus, we believe that this study could serve as a valuable platform to assess the synergetic anticancer effects of the herbal as well as synthetic medicines. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. | Click |
| 2 | Apatinib and Ginsenoside-Rb1 Synergetically Control the Growth of Hypopharyngeal Carcinoma Cells. Dis Markers. 2022 Jan 13;2022:3833489. doi: 10.1155/2022/3833489. | Click |