TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Caspase-6
UniProt ID CASP6_HUMAN
Gene Name CASP6
Gene ID 839
Synonyms
CASP6, CSP-6, MCH2, caspase-6
Sequence
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLT
LPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLS
HGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDN
QTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYG
SSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Pathway Map MAP LINK
KEGG ID hsa839
TTD ID T20600
Pfam PF00656
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 637
Pair Name Apigenin, TNF-related apoptosis inducing ligand
Phytochemical Apigenin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Caspase-6 Cleavage
Result Apigenin sensitizes cells to TRAIL-induced apoptosis by activating both intrinsic and extrinsic apoptotic pathway-related caspases. The augmented apoptotic effect by TRAIL/apigenin combination was accompanied by triggering mitochondria-dependent signaling pathway, as indicated by Bax/Bcl-2 ratio up-regulation
Combination Pair ID: 661
Pair Name Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical Epigallocatechin gallate
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Caspase-6 Expression
Result EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis
Combination Pair ID: 840
Pair Name Luteolin, Cisplatin
Phytochemical Luteolin
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Caspase-6 Expression
Result These findings indicate the anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cells and luteolin may be a promising candidate agent used in the treatment of gastric cancer.
03. Reference
No. Title Href
1 Apigenin Sensitizes Huh-7 Human Hepatocellular Carcinoma Cells to TRAIL-induced Apoptosis. Biomol Ther (Seoul). 2012 Jan;20(1):62-7. doi: 10.4062/biomolther.2012.20.1.062. Click
2 Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. Click
3 Anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cell line. Mol Cell Biochem. 2008 Jun;313(1-2):125-32. doi: 10.1007/s11010-008-9749-x. Click
It has been 584217 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP