Name | Caspase-6 | ||
UniProt ID | CASP6_HUMAN | ||
Gene Name | CASP6 | ||
Gene ID | 839 | ||
Synonyms |
CASP6, CSP-6, MCH2, caspase-6
|
||
Sequence |
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLT
LPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLS HGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDN QTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYG SSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa839 | ||
TTD ID | T20600 | ||
Pfam | PF00656 |
Pair Name | Apigenin, TNF-related apoptosis inducing ligand | |||
Phytochemical | Apigenin | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Caspase-6 | Cleavage | |
Result | Apigenin sensitizes cells to TRAIL-induced apoptosis by activating both intrinsic and extrinsic apoptotic pathway-related caspases. The augmented apoptotic effect by TRAIL/apigenin combination was accompanied by triggering mitochondria-dependent signaling pathway, as indicated by Bax/Bcl-2 ratio up-regulation |
Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
Phytochemical | Epigallocatechin gallate | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C82.0] | Prostate cancer | Investigative | |
Regulate Info | Down-regulation | Caspase-6 | Expression | |
Result | EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis |
Pair Name | Luteolin, Cisplatin | |||
Phytochemical | Luteolin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Caspase-6 | Expression | |
Result | These findings indicate the anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cells and luteolin may be a promising candidate agent used in the treatment of gastric cancer. |
No. | Title | Href |
---|---|---|
1 | Apigenin Sensitizes Huh-7 Human Hepatocellular Carcinoma Cells to TRAIL-induced Apoptosis. Biomol Ther (Seoul). 2012 Jan;20(1):62-7. doi: 10.4062/biomolther.2012.20.1.062. | Click |
2 | Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. | Click |
3 | Anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cell line. Mol Cell Biochem. 2008 Jun;313(1-2):125-32. doi: 10.1007/s11010-008-9749-x. | Click |