| Name | Caspase-6 | ||
| UniProt ID | CASP6_HUMAN | ||
| Gene Name | CASP6 | ||
| Gene ID | 839 | ||
| Synonyms |
CASP6, CSP-6, MCH2, caspase-6
|
||
| Sequence |
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLT
LPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLS HGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDN QTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYG SSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa839 | ||
| TTD ID | T20600 | ||
| Pfam | PF00656 | ||
| Pair Name | Apigenin, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Apigenin | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Caspase-6 | Cleavage | |
| Result | Apigenin sensitizes cells to TRAIL-induced apoptosis by activating both intrinsic and extrinsic apoptotic pathway-related caspases. The augmented apoptotic effect by TRAIL/apigenin combination was accompanied by triggering mitochondria-dependent signaling pathway, as indicated by Bax/Bcl-2 ratio up-regulation | |||
| Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Epigallocatechin gallate | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Down-regulation | Caspase-6 | Expression | |
| Result | EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis | |||
| Pair Name | Luteolin, Cisplatin | |||
| Phytochemical | Luteolin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Caspase-6 | Expression | |
| Result | These findings indicate the anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cells and luteolin may be a promising candidate agent used in the treatment of gastric cancer. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Apigenin Sensitizes Huh-7 Human Hepatocellular Carcinoma Cells to TRAIL-induced Apoptosis. Biomol Ther (Seoul). 2012 Jan;20(1):62-7. doi: 10.4062/biomolther.2012.20.1.062. | Click |
| 2 | Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. | Click |
| 3 | Anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cell line. Mol Cell Biochem. 2008 Jun;313(1-2):125-32. doi: 10.1007/s11010-008-9749-x. | Click |
