
| Name | Cyclic AMP-dependent transcription factor ATF-6 alpha | ||
| UniProt ID | ATF6A_HUMAN | ||
| Gene Name | ATF6 | ||
| Gene ID | 22926 | ||
| Synonyms |
ATF6, ACHM7, ATF6A, ATP6alpha
|
||
| Sequence |
MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNL
DFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEE LDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQ PKPLLLPAAPKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTV VQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV GSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGTLKRQLD EVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQDSRRMNPSVSPANQRRHLLG FSAKEAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTTESLRLN HELRGWVHRHEVERTKSRRMTNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGS ELQVYYASPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAINI NENVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQTNTFFGSPPAATEATH VVSTIPESLQ |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 3.A.1.203.1 | ||
| KEGG ID | hsa22926 | ||
| Pfam | PF00170; PF03131; PF03961; PF04452; PF06005; PF07716; PF08990; PF14197; PF21037 | ||
| Pair Name | Piperlongumine, Bortezomib | |||
| Phytochemical | Piperlongumine | |||
| Drug | Bortezomib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Cyclic AMP-dependent transcription factor ATF-6 alpha | Expression | |
| Result | Piperlongumine and bortezomib synergically inhibit cholangiocarcinoma via ER stress-induced cell death | |||
| Pair Name | Kaempferol, Cisplatin | |||
| Phytochemical | Kaempferol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Up-regulation | Cyclic AMP-dependent transcription factor ATF-6 alpha | Expression | |
| Result | Kaempferol Induces cell death in A2780 ovarian cancer cells and increases their sensitivity to cisplatin by activation of cytotoxic endoplasmic reticulum-mediated autophagy and inhibition of protein kinase B | |||
| Pair Name | Tannic acid, Cisplatin | |||
| Phytochemical | Tannic acid | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Cyclic AMP-dependent transcription factor ATF-6 alpha | Expression | |
| Result | The combination of TA and CDDP may produce synergistic antitumoral effects mediated by the PERK-ATF4-CHOP apoptotic axis, suggesting a novel adjuvant treatment for lung cancer. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Piperlongumine and bortezomib synergically inhibit cholangiocarcinoma via ER stress-induced cell death. Naunyn Schmiedebergs Arch Pharmacol. 2023 Jan;396(1):109-120. doi: 10.1007/s00210-022-02305-4. | Click |
| 2 | Kaempferol Induces Cell Death in A2780 Ovarian Cancer Cells and Increases Their Sensitivity to Cisplatin by Activation of Cytotoxic Endoplasmic Reticulum-Mediated Autophagy and Inhibition of Protein Kinase B. Folia Biol (Praha). 2020;66(1):36-46. | Click |
| 3 | Synergistic anticancer activity of cisplatin combined with tannic acid enhances apoptosis in lung cancer through the PERK-ATF4 pathway. Eur J Med Res. 2023 Oct 27;28(1):462. doi: 10.1186/s40001-023-01420-z. | Click |