Name | Cyclic AMP-dependent transcription factor ATF-6 alpha | ||
UniProt ID | ATF6A_HUMAN | ||
Gene Name | ATF6 | ||
Gene ID | 22926 | ||
Synonyms |
ATF6, ACHM7, ATF6A, ATP6alpha
|
||
Sequence |
MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNL
DFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEE LDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQ PKPLLLPAAPKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTV VQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV GSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGTLKRQLD EVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQDSRRMNPSVSPANQRRHLLG FSAKEAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTTESLRLN HELRGWVHRHEVERTKSRRMTNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGS ELQVYYASPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAINI NENVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQTNTFFGSPPAATEATH VVSTIPESLQ |
||
Pathway Map | MAP LINK | ||
T.C. Number | 3.A.1.203.1 | ||
KEGG ID | hsa22926 | ||
Pfam | PF00170; PF03131; PF03961; PF04452; PF06005; PF07716; PF08990; PF14197; PF21037 |
Pair Name | Kaempferol, Cisplatin | |||
Phytochemical | Kaempferol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Up-regulation | Cyclic AMP-dependent transcription factor ATF-6 alpha | Expression | |
Result | Kaempferol Induces cell death in A2780 ovarian cancer cells and increases their sensitivity to cisplatin by activation of cytotoxic endoplasmic reticulum-mediated autophagy and inhibition of protein kinase B |
Pair Name | Piperlongumine, Bortezomib | |||
Phytochemical | Piperlongumine | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Cyclic AMP-dependent transcription factor ATF-6 alpha | Expression | |
Result | Piperlongumine and bortezomib synergically inhibit cholangiocarcinoma via ER stress-induced cell death |
Pair Name | Tannic acid, Cisplatin | |||
Phytochemical | Tannic acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Cyclic AMP-dependent transcription factor ATF-6 alpha | Expression | |
Result | The combination of TA and CDDP may produce synergistic antitumoral effects mediated by the PERK-ATF4-CHOP apoptotic axis, suggesting a novel adjuvant treatment for lung cancer. |
No. | Title | Href |
---|---|---|
1 | Kaempferol Induces Cell Death in A2780 Ovarian Cancer Cells and Increases Their Sensitivity to Cisplatin by Activation of Cytotoxic Endoplasmic Reticulum-Mediated Autophagy and Inhibition of Protein Kinase B. Folia Biol (Praha). 2020;66(1):36-46. | Click |
2 | Piperlongumine and bortezomib synergically inhibit cholangiocarcinoma via ER stress-induced cell death. Naunyn Schmiedebergs Arch Pharmacol. 2023 Jan;396(1):109-120. doi: 10.1007/s00210-022-02305-4. | Click |
3 | Synergistic anticancer activity of cisplatin combined with tannic acid enhances apoptosis in lung cancer through the PERK-ATF4 pathway. Eur J Med Res. 2023 Oct 27;28(1):462. doi: 10.1186/s40001-023-01420-z. | Click |