| Name | Arginase-1 | ||
| UniProt ID | ARGI1_HUMAN | ||
| Gene Name | ARG1 | ||
| Gene ID | 383 | ||
| Synonyms |
ARG1
|
||
| Sequence |
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN
DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT LACFGLAREGNHKPIDYLNPPK |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.A.23.1.1; 1.B.40.2.4; 2.A.29.9.2; 2.A.69.1.4; 3.A.1.4.11 | ||
| KEGG ID | hsa383 | ||
| TTD ID | T63224 | ||
| Pfam | PF00491 | ||
| Pair Name | All-trans retinoic acid, Anti-PD-L1 antibody | |||
| Phytochemical | All-trans-retinoic acid | |||
| Drug | Anti-PD-L1 antibody | |||
| Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
| Regulate Info | Down-regulation | Arginase-1 | Expression | |
| Result | Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer. | |||
| Pair Name | Carnosic acid, Cisplatin | |||
| Phytochemical | Carnosic acid | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Arginase-1 | Expression | |
| Result | Our study proved that the functional suppression of MDSC by carnosic acid promoted the lethality of CD8 T cells, which contributed to the enhancement of anti-lung cancer effect of cisplatin. | |||
| Pair Name | Quercetin, Anti-PD-1 antibody | |||
| Phytochemical | Quercetin | |||
| Drug | Anti-PD-1 antibody | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Arginase-1 | Expression | |
| Result | Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer. Sci Rep. 2022 Jun 10;12(1):9619. doi: 10.1038/s41598-022-13855-1. | Click |
| 2 | Carnosic acid enhances the anti-lung cancer effect of cisplatin by inhibiting myeloid-derived suppressor cells. Chin J Nat Med. 2018 Dec;16(12):907-915. doi: 10.1016/S1875-5364(18)30132-8. | Click |
| 3 | Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. | Click |
